TA343055 CYP2W1 antibody

Rabbit Polyclonal Anti-CYP2W1 Antibody

See related secondary antibodies

Search for all "CYP2W1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rat CYP2W1

Product Description for CYP2W1

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rat CYP2W1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CYP2W1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CYPIIW1, Cytochrome P450 2W1
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TAV3
Immunogen:
The immunogen for anti-CYP2W1 antibody: synthetic peptide directed towards the C terminal of human CYP2W1. Synthetic peptide located within the following region: PVCSYVDALIQQGQGDDPEGLFAEANAVACTLDMVMAGTETTSATLQWAA.
GeneID:
54905
Application WB
Background This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygeses which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 814% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CYP2W1 (4 products)

Catalog No. Species Pres. Purity   Source  

CYP2W1

CYP2W1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

CYP2W1

CYP2W1 Human
  Abnova Taiwan Corp.

CYP2W1

CYP2W1 Human in vitro transl.
  Abnova Taiwan Corp.

CYP2W1

CYP2W1 Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CYP2W1 (2 products)

Catalog No. Species Pres. Purity   Source  

CYP2W1 Lysate

Western Blot: CYP2W1 Lysate [NBL1-09691] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CYP2W1
  Novus Biologicals Inc.

CYP2W1 overexpression lysate

CYP2W1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn