TA343061 ACSBG1 antibody

Rabbit Polyclonal Anti-ACSBG1 Antibody

See related secondary antibodies

Search for all "ACSBG1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ACSBG1

Product Description for ACSBG1

Rabbit anti Human ACSBG1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ACSBG1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Acyl-CoA synthetase bubblegum family member 1, BGM, KIAA0631, LPD, Lipodisin, Long-chain-fatty-acid--CoA ligase ACSBG1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96GR2
Immunogen:
The immunogen for anti-ACSBG1 antibody is: synthetic peptide directed towards the N-terminal region of Human ACSBG1. Synthetic peptide located within the following region: DPSMLDSRETPQESRQDMIVRTTQEKLKTSSLTDRQPLSKESLNHALELS.
GeneID:
23205
Application WB
Background The protein encoded by this gene possesses long-chain acyl-CoA synthetase activity. It is thought to play a central role in brain very long-chain fatty acids metabolism and myelinogenesis.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 820% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ACSBG1 (2 products)

Catalog No. Species Pres. Purity   Source  

ACSBG1

ACSBG1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ACSBG1

ACSBG1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ACSBG1 (2 products)

Catalog No. Species Pres. Purity   Source  

ACSBG1 293T Cell Transient Overexpression Lysate(Denatured)

ACSBG1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ACSBG1 Lysate

Western Blot: ACSBG1 Lysate [NBL1-07259] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ACSBG1 Protein
  Novus Biologicals Inc.
  • LinkedIn