TA343064 ACSM3 antibody

Rabbit Polyclonal Anti-ACSM3 Antibody

See related secondary antibodies

Search for all "ACSM3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit ACSM3

Product Description for ACSM3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit ACSM3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ACSM3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Acyl-CoA synthetase medium-chain family member 3, Acyl-coenzyme A synthetase ACSM3 mitochondrial, Butyrate-CoA ligase 3, Butyryl coenzyme A synthetase 3, Middle-chain acyl-CoA synthetase 3, Protein SA homolog, SAH
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q53FZ2
Immunogen:
The immunogen for anti-ACSM3 antibody: synthetic peptide directed towards the N terminal of human ACSM3. Synthetic peptide located within the following region: SMKQDFKLGIPEYFNFAKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMR.
GeneID:
6296
Application WB
Background Q53FZ2 has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). It acts on acids from C4 to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4-unsaturated acids (in vitro).
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 823% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ACSM3 (2 products)

Catalog No. Species Pres. Purity   Source  

ACSM3

ACSM3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ACSM3

ACSM3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ACSM3 (2 products)

Catalog No. Species Pres. Purity   Source  

ACSM3 293T Cell Transient Overexpression Lysate(Denatured)

ACSM3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ACSM3 overexpression lysate

ACSM3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn