TA343073 Adiponectin Receptor 2 antibody

Rabbit Polyclonal Anti-ADIPOR2 Antibody

See related secondary antibodies

Search for all "Adiponectin Receptor 2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Guinea Pig, Human, Porcine, Rabbit Adiponectin Receptor 2

Product Description for Adiponectin Receptor 2

Rabbit anti Canine, Guinea Pig, Human, Porcine, Rabbit Adiponectin Receptor 2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Adiponectin Receptor 2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ADIPOR2, PAQR2, Progestin and adipoQ receptor family member II
Presentation Purified
Reactivity Can, GP, Hu, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86V24
Immunogen:
The immunogen for anti-ADIPOR2 antibody: synthetic peptide directed towards the N terminal of human ADIPOR2. Synthetic peptide located within the following region: ASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCK.
GeneID:
79602
Application WB
Background The adiponectin receptors, ADIPOR1 and ADIPOR2, serve as receptors for globular and full-length adiponectin and mediate increased AMPK and PPAR-alpha ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 832% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Adiponectin Receptor 2 (3 products)

Catalog No. Species Pres. Purity   Source  

Adiponectin Receptor 2

Adiponectin Receptor 2 Human
  Abnova Taiwan Corp.

Adiponectin Receptor 2

Adiponectin Receptor 2 Human Purified
  Abnova Taiwan Corp.

Adiponectin Receptor 2

Adiponectin Receptor 2 Human Purified
  Abnova Taiwan Corp.

Positive controls for Adiponectin Receptor 2 (2 products)

Catalog No. Species Pres. Purity   Source  

Adiponectin Receptor 2 Lysate

Western Blot: Adiponectin Receptor 2 Lysate [NBL1-07344] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ADIPOR2 Protein
  Novus Biologicals Inc.

ADIPOR2 overexpression lysate

ADIPOR2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn