TA343088 Cathepsin S antibody

Rabbit Polyclonal Anti-CTSS Antibody

See related secondary antibodies

Search for all "Cathepsin S"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat Cathepsin S

Product Description for Cathepsin S

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat Cathepsin S.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Cathepsin S

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CTSS, Cathepsin-S
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P25774
Immunogen:
The immunogen for anti-CTSS antibody: synthetic peptide directed towards the N terminal of human CTSS. Synthetic peptide located within the following region: QLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEH.
GeneID:
1520
Application WB
Background The protein encoded by this gene, a member of the peptidase C1 family, is a lysosomal cysteine proteise that may participate in the degradation of antigenic proteins to peptides for presentation on MHC class II molecules. The encoded protein can function as an elastase over a broad pH range in alveolar macrophages. Altertively spliced transcript variants encoding distinct isoforms have been found for this gene.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 847% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Cathepsin S (5 products)

Catalog No. Species Pres. Purity   Source  

Cathepsin S

Cathepsin S Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
  OriGene Technologies, Inc.

Cathepsin S (17-331, His-tag)

Cathepsin S Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

Cathepsin S (17-331, His-tag)

Cathepsin S Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

Cathepsin S

Cathepsin S Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Cathepsin S

Cathepsin S Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Cathepsin S (4 products)

Catalog No. Species Pres. Purity   Source  

Cathepsin S Lysate

Western Blot: Cathepsin S Lysate [NBL1-09598] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CTSS
  Novus Biologicals Inc.

CTSS 293T Cell Transient Overexpression Lysate(Denatured)

CTSS 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CTSS 293T Cell Transient Overexpression Lysate(Denatured)

CTSS 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CTSS overexpression lysate

CTSS overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn