TA343095 PI15 antibody

Rabbit Polyclonal Anti-PI15 Antibody

See related secondary antibodies

Search for all "PI15"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish PI15

TA343095

More Views

  • TA343095

Product Description for PI15

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish PI15.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PI15

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 25 kDa trypsin inhibitor, CRISP-8, CRISP8, Cysteine-rich secretory protein 8, P25TI, PI-15, Peptidase inhibitor 15, SugarCrisp
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O43692
Immunogen:
The immunogen for anti-PI15 antibody: synthetic peptide directed towards the N terminal of human PI15. Synthetic peptide located within the following region: PPTNNFTDIEAALKAQLDSADIPKARRKRYISQNDMIAILDYHNQVRGKV.
GeneID:
51050
Application WB
Background This gene encodes a trypsin inhibitor. The protein shares similarity to insect venom allergens, mammalian testis-specific proteins and plant pathogenesis-related proteins. It is frequently expressed in human neuroblastoma and glioblastoma cell lines, and thus may play a role in the central nervous system.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 854% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PI15 (4 products)

Catalog No. Species Pres. Purity   Source  

PI15

PI15 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PI15

PI15 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PI15

PI15 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PI15

PI15 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PI15 (2 products)

Catalog No. Species Pres. Purity   Source  

PI15 293T Cell Transient Overexpression Lysate(Denatured)

PI15 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PI15 overexpression lysate

PI15 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn