Hexokinase-1 - TA343098 | acris-antibodies.com

Product Description for Hexokinase-1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Hexokinase-1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Hexokinase-1

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	Brain form hexokinase, HK1, Hexokinase type I
Presentation	Purified
Reactivity	Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Datasheet Extract

Immunogen	Swiss Prot Num: P19367 Immunogen: The immunogen for anti-HK1 antibody: synthetic peptide directed towards the middle region of human HK1. Synthetic peptide located within the following region: ILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTR. GeneID: 3098
Application	WB
Background	Hexokises phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes a ubiquitous form of hexokise which localizes to the outer membrane of mitochondria. Mutations in this gene have been associated with hemolytic anemia due to hexokise deficiency. Altertive splicing of this gene results in five transcript variants which encode different isoforms, some of which are tissue-specific. Each isoform has a distinct N-terminus; the remainder of the protein is identical among all the isoforms. A sixth transcript variant has been described, but due to the presence of several stop codons, it is not thought to encode a protein.
Format	Buffer System: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 857% sucrose. State: Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Hexokinase-1 (14 products)

Catalog No.	Species	Pres.	Purity	Source
TP300464	Hexokinase-1 (transcript variant 1)
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €788.00
					OriGene Technologies, Inc.
AR09040PU-L	Hexokinase-1 (1-917, His-tag)
	Human	Purified	> 90 % by SDS PAGE	E. coli	0.5 mg / €1,570.00
					OriGene Technologies GmbH
AR09040PU-N	Hexokinase-1 (1-917, His-tag)
	Human	Purified	> 90 % by SDS PAGE	E. coli	0.1 mg / €570.00
					OriGene Technologies GmbH
H00003098-P01-10	Hexokinase-1
	Human	Purified
					Abnova Taiwan Corp.
H00003098-P01-25	Hexokinase-1
	Human	Purified
					Abnova Taiwan Corp.
H00003098-P02	Hexokinase-1
	Human	Purified
					Abnova Taiwan Corp.
H00003098-P02-10	Hexokinase-1
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00003098-P02-25	Hexokinase-1
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00003098-Q01-10	Hexokinase-1
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00003098-Q01-25	Hexokinase-1
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
P3162	Hexokinase-1
	Human
					Abnova Taiwan Corp.
P3163	Hexokinase-1
	Human
					Abnova Taiwan Corp.
P3458	Hexokinase-1
	Human
					Abnova Taiwan Corp.
NBC1-18390	Hexokinase-1
			Protein
					Novus Biologicals Inc.

Positive controls for Hexokinase-1 (2 products)

Catalog No.	Species
NBL1-11578	Hexokinase Lysate

		Novus Biologicals Inc.
H00003098-T01	HK1 293T Cell Transient Overexpression Lysate(Denatured)

		Abnova Taiwan Corp.

Recommended Secondary Antibodies for Hexokinase-1 (9 products)

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH