TA343122 NQO1 antibody

Rabbit Polyclonal Anti-NQO1 Antibody

See related secondary antibodies

Search for all "NQO1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Rabbit, Rat NQO1

Product Description for NQO1

Rabbit anti Bovine, Canine, Human, Rabbit, Rat NQO1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NQO1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Azoreductase, DIA4, DT-diaphorase, Menadione reductase, NAD(P)H dehydrogenase [quinone] 1, NAD(P)H:quinone oxidoreductase 1, NMOR1, Phylloquinone reductase, Quinone reductase 1
Presentation Purified
Reactivity Bov, Can, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P15559
Immunogen:
The immunogen for anti-NQO1 antibody: synthetic peptide directed towards the C terminal of human NQO1. Synthetic peptide located within the following region: WKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVG.
GeneID:
1728
Application WB
Background This gene is a member of the D(P)H dehydrogese (quinone) family and encodes a cytoplasmic 2-electron reductase. This FAD-binding protein forms homodimers and reduces quinones to hydroquinones. This protein's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimer's disease (AD). Alterte transcriptiol splice variants, encoding different isoforms, have been characterized.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 881% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NQO1 (6 products)

Catalog No. Species Pres. Purity   Source  

NQO1 (transcript variant 1)

NQO1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NQO1 (1-274 , His-tag)

NQO1 Human Purified > 95 % pure by SDS–PAGE E. coli
0.5 mg / €1,570.00
  OriGene Technologies GmbH

NQO1 (1-274 , His-tag)

NQO1 Human Purified > 95 % pure by SDS–PAGE E. coli
0.1 mg / €570.00
  OriGene Technologies GmbH

NQO1

NQO1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NQO1

NQO1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NQO1

SDS-Page: NQO1 Protein [NBP1-30240] - NQO1, 33.0 kDa (294aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE
  Novus Biologicals Inc.

Positive controls for NQO1 (4 products)

Catalog No. Species Pres. Purity   Source  

NQO1 293T Cell Transient Overexpression Lysate(Denatured)

NQO1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NQO1 Lysate

Western Blot: NQO1 Lysate [NBL1-13761] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NQO1
  Novus Biologicals Inc.

NQO1 overexpression lysate

NQO1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

NQO1 overexpression lysate

NQO1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn