TA343124 PFKM antibody

Rabbit Polyclonal Anti-PFKM Antibody

See related secondary antibodies

Search for all "PFKM"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish PFKM

Product Description for PFKM

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish PFKM.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PFKM

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 6-phosphofructokinase muscle type, GSD7, PFK-1, PFK-A, PFK1, PFKX, Phosphofructo-1-kinase isozyme A, Phosphofructokinase 1, Phosphofructokinase-M, Phosphohexokinase
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P08237
Immunogen:
The immunogen for anti-PFKM antibody: synthetic peptide directed towards the C terminal of human PFKM. Synthetic peptide located within the following region: RALVFQPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHA.
GeneID:
5213
Application WB
Background Three phosphofructokise isozymes exist in humans: muscle, liver and platelet. These isozymes function as subunits of the mammalian tetramer phosphofructokise, which catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-bisphosphate. Tetramer composition varies depending on tissue type. This gene encodes the muscle-type isozyme. Mutations in this gene have been associated with glycogen storage disease type VII, also known as Tarui disease. Altertively spliced transcript variants have been described.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 883% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PFKM (10 products)

Catalog No. Species Pres. Purity   Source  

PFKM

PFKM Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PFKM (1-780, His-tag)

PFKM Human Purified > 80 % by SDS - PAGE E. coli
0.5 mg / €1,070.00
  OriGene Technologies GmbH

PFKM (1-780, His-tag)

PFKM Human Purified > 80 % by SDS - PAGE E. coli
0.1 mg / €400.00
  OriGene Technologies GmbH

PFKM

PFKM Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PFKM

PFKM Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PFKM

PFKM Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PFKM

PFKM Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PFKM

PFKM Human
  Abnova Taiwan Corp.

PFKM

PFKM Human
  Abnova Taiwan Corp.

PFKM

SDS-Page: PFK-1 Protein [NBP1-44494] - PFKM, 87.3 kDa (800aa), confirmed by MALDI-TOF with a purity of 80% by SDS - PAGE Human Purified
  Novus Biologicals Inc.

Positive controls for PFKM (2 products)

Catalog No. Species Pres. Purity   Source  

PFK-1 Lysate

Western Blot: PFK-1 Lysate [NBL1-14316] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PFKM
  Novus Biologicals Inc.

PFKM 293T Cell Transient Overexpression Lysate(Denatured)

PFKM 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn