TA343146 PTGDR antibody

Rabbit Polyclonal Anti-PTGDR Antibody

See related secondary antibodies

Search for all "PTGDR"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human PTGDR

Product Description for PTGDR

Rabbit anti Human PTGDR.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PTGDR

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ASRT1, PGD receptor, PGD2 receptor, Prostaglandin D2 receptor, Prostanoid DP receptor
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13258
Immunogen:
The immunogen for anti-PTGDR antibody: synthetic peptide directed towards the C terminal of human PTGDR. Synthetic peptide located within the following region: FKDVKEKNRTSEEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIF.
GeneID:
5729
Application WB
Background PTGDR is a receptor for prostaglandin D2 (PGD2). The activity of this receptor is mainly mediated by G(s) proteins that stimulate adenylate cyclase, resulting in an elevation of intracellular cAMP. A mobilization of calcium is also observed, but without formation of inositol 1,4,5-trisphosphate.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 905% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PTGDR (3 products)

Catalog No. Species Pres. Purity   Source  

PTGDR

PTGDR Human
  Abnova Taiwan Corp.

PTGDR

PTGDR Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PTGDR

PTGDR Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PTGDR (2 products)

Catalog No. Species Pres. Purity   Source  

PTGDR 293T Cell Transient Overexpression Lysate(Denatured)

PTGDR 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PTGDR overexpression lysate

PTGDR overexpression lysate
  OriGene Technologies, Inc.
  • LinkedIn