TA343155 GRK6 antibody

Rabbit Polyclonal Anti-GRK6 Antibody

See related secondary antibodies

Search for all "GRK6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat GRK6

Product Description for GRK6

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat GRK6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GRK6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms G protein-coupled receptor kinase 6, G protein-coupled receptor kinase GRK6, GPRK6
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P43250
Immunogen:
The immunogen for anti-GRK6 antibody is: synthetic peptide directed towards the C-terminal region of Human GRK6. Synthetic peptide located within the following region: LYEMIAGQSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQARSLCSQLL.
GeneID:
2870
Application WB
Background This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kise subfamily of the Ser/Thr protein kise family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. Several transcript variants encoding different isoforms have been described for this gene.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 914% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GRK6 (7 products)

Catalog No. Species Pres. Purity   Source  

GRK6 (transcript variant 1)

GRK6 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

GRK6

GRK6 Human Purified
  Abnova Taiwan Corp.

GRK6

GRK6 Human Purified
  Abnova Taiwan Corp.

GRK6

GRK6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GRK6

GRK6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GRK6

GRK6 Human
  Abnova Taiwan Corp.

GRK6

GRK6 Human
  Abnova Taiwan Corp.

Positive controls for GRK6 (3 products)

Catalog No. Species Pres. Purity   Source  

GRK6 293T Cell Transient Overexpression Lysate(Denatured)

GRK6 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

GRK6 Lysate

Western Blot: GRK6 Lysate [NBL1-11344] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GRK6
  Novus Biologicals Inc.

GRK6 overexpression lysate

GRK6 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn