TA343193 LMAN2 antibody

Rabbit Polyclonal Anti-LMAN2 Antibody

See related secondary antibodies

Search for all "LMAN2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish LMAN2

Product Description for LMAN2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish LMAN2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LMAN2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C5orf8, Glycoprotein GP36b, LMAN2, Lectin mannose-binding 2, Vesicular integral-membrane protein VIP36
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q12907
Immunogen:
The immunogen for anti-Lman2 antibody is: synthetic peptide directed towards the N-terminal region of Rat Lman2. Synthetic peptide located within the following region: QGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEM.
GeneID:
10960
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 953% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LMAN2 (4 products)

Catalog No. Species Pres. Purity   Source  

LMAN2

LMAN2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

LMAN2

LMAN2 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €299.00
  OriGene Technologies, Inc.

LMAN2

LMAN2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

LMAN2

LMAN2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for LMAN2 (1 products)

Catalog No. Species Pres. Purity   Source  

LMAN2 overexpression lysate

LMAN2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn