TA343194 PITPNB antibody

Rabbit Polyclonal Anti-PITPNB Antibody

See related secondary antibodies

Search for all "PITPNB"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PITPNB

Product Description for PITPNB

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PITPNB.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PITPNB

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PI-TP-beta, Phosphatidylinositol transfer protein beta isoform, PtdIns transfer protein beta, PtdInsTP beta
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P48739
Immunogen:
The immunogen for anti-PITPNB antibody is: synthetic peptide directed towards the N-terminal region of Human PITPNB. Synthetic peptide located within the following region: EGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKA.
GeneID:
23760
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 954% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PITPNB (9 products)

Catalog No. Species Pres. Purity   Source  

PITPNB

PITPNB Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PITPNB (1-271, His-tag)

PITPNB Human Purified > 95 % E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

PITPNB (1-271, His-tag)

PITPNB Human Purified > 95 % E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

PITPNB

PITPNB Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PITPNB

PITPNB Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PITPNB

PITPNB Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PITPNB

PITPNB Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PITPNB

PITPNB Human Purified
  Novus Biologicals Inc.

PITPNB

PITPNB Human Purified
  Novus Biologicals Inc.

Positive controls for PITPNB (2 products)

Catalog No. Species Pres. Purity   Source  

PITPNB Lysate

Western Blot: PITPNB Lysate [NBL1-14443] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PITPNB
  Novus Biologicals Inc.

PITPNB overexpression lysate

PITPNB overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn