TA343196 Tumor protein D54 (TPD52L2) antibody

Rabbit Polyclonal Anti-TPD52L2 Antibody

See related secondary antibodies

Search for all "Tumor protein D54 (TPD52L2)"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Tumor protein D54 (TPD52L2)

Product Description for Tumor protein D54 (TPD52L2)

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Tumor protein D54 (TPD52L2).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Tumor protein D54 (TPD52L2)

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Tumor protein D52-like 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O43399
Immunogen:
The immunogen for anti-TPD52L2 antibody is: synthetic peptide directed towards the middle region of Human TPD52L2. Synthetic peptide located within the following region: QVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSA.
GeneID:
7165
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 956% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Tumor protein D54 (TPD52L2) (3 products)

Catalog No. Species Pres. Purity   Source  

Tumor protein D54 (TPD52L2) (transcript variant 5)

Tumor protein D54 (TPD52L2) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Tumor protein D54 (TPD52L2)

Tumor protein D54 (TPD52L2) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Tumor protein D54 (TPD52L2)

Tumor protein D54 (TPD52L2) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Tumor protein D54 (TPD52L2) (2 products)

Catalog No. Species Pres. Purity   Source  

TPD52L2 overexpression lysate

TPD52L2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

TPD52L2 overexpression lysate

TPD52L2 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn