TA343202 CNKSR1 antibody

Rabbit Polyclonal Anti-CNKSR1 Antibody

See related secondary antibodies

Search for all "CNKSR1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CNKSR1

Product Description for CNKSR1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CNKSR1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CNKSR1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CNK homolog protein 1, CNK1, Connector enhancer of KSR-like, Connector enhancer of KSR1, Connector enhancer of kinase suppressor of ras 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q969H4
Immunogen:
The immunogen for anti-CNKSR1 antibody is: synthetic peptide directed towards the middle region of Human CNKSR1. Synthetic peptide located within the following region: VLKGHTLYWYRQPQDEKAEGLINVSNYSLESGHDQKKKYVFQLTHDVYKP.
GeneID:
10256
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 962% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CNKSR1 (2 products)

Catalog No. Species Pres. Purity   Source  

CNKSR1

CNKSR1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CNKSR1

CNKSR1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CNKSR1 (1 products)

Catalog No. Species Pres. Purity   Source  

CNKSR1 293T Cell Transient Overexpression Lysate(Denatured)

CNKSR1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn