TA343214 CYTIP / PSCDBP antibody

Rabbit Polyclonal Anti-CYTIP Antibody

See related secondary antibodies

Search for all "CYTIP / PSCDBP"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish CYTIP / PSCDBP

Product Description for CYTIP / PSCDBP

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish CYTIP / PSCDBP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CYTIP / PSCDBP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CASP, CYBR, Cytohesin binder and regulator, Cytohesin-associated scaffolding protein, Cytohesin-binding protein HE, Cytohesin-interacting protein, PSCDBP, Pleckstrin homology Sec7 and coiled-coil domains-binding protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O60759
Immunogen:
The immunogen for anti-Cytip antibody is: synthetic peptide directed towards the C-terminal region of Mouse Cytip. Synthetic peptide located within the following region: RNRSISVTSSGSFSPLWESNYSSVFGTLPRKSRRGSVRKQILKFIPGLHR.
GeneID:
9595
Application WB
Background By its binding to cytohesin-1 (CYTH1), Cytip modifies activation of ARFs by CYTH1 and its precise function may be to sequester CYTH1 in the cytoplasm.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 974% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CYTIP / PSCDBP (3 products)

Catalog No. Species Pres. Purity   Source  

CYTIP / PSCDBP (full length, N-term HIS tag)

CYTIP / PSCDBP Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

CYTIP / PSCDBP (1-359, His-tag)

CYTIP / PSCDBP Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

CYTIP / PSCDBP (1-359, His-tag)

CYTIP / PSCDBP Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

Positive controls for CYTIP / PSCDBP (2 products)

Catalog No. Species Pres. Purity   Source  

CYTIP Lysate

Western Blot: CYTIP Lysate [NBL1-14859] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CYTIP
  Novus Biologicals Inc.

CYTIP overexpression lysate

CYTIP overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn