TA343220 FAM167A antibody

Rabbit Polyclonal Anti-FAM167A Antibody

See related secondary antibodies

Search for all "FAM167A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish FAM167A

Product Description for FAM167A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish FAM167A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM167A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C8orf13
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96KS9
Immunogen:
The immunogen for anti-FAM167A antibody is: synthetic peptide directed towards the C-terminal region of Human FAM167A. Synthetic peptide located within the following region: GDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTP.
GeneID:
83648
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 980% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for FAM167A (1 products)

Catalog No. Species Pres. Purity   Source  

FAM167A overexpression lysate

FAM167A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn