TA343222 MED29 antibody

Rabbit Polyclonal Anti-MED29 Antibody

See related secondary antibodies

Search for all "MED29"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish MED29

Product Description for MED29

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish MED29.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MED29

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms IXL, Intersex-like protein, Mediator complex subunit 29, Mediator of RNA polymerase II transcription subunit 29
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NX70
Immunogen:
The immunogen for anti-Med29 antibody is: synthetic peptide directed towards the middle region of Mouse Med29. Synthetic peptide located within the following region: LQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPD.
GeneID:
55588
Application WB
Background Med29 is a component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all R polymerase II-dependent genes. It mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal R polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functiol preinitiation complex with R polymerase II and the general transcription factors.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 982% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MED29 (3 products)

Catalog No. Species Pres. Purity   Source  

MED29

MED29 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

MED29

MED29 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MED29

MED29 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for MED29 (1 products)

Catalog No. Species Pres. Purity   Source  

IXL 293T Cell Transient Overexpression Lysate(Denatured)

IXL 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn