TA343256 PLCXD1 antibody

Rabbit Polyclonal Anti-PLCXD1 Antibody

See related secondary antibodies

Search for all "PLCXD1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Rabbit, Rat PLCXD1

Product Description for PLCXD1

Rabbit anti Bovine, Canine, Equine, Human, Rabbit, Rat PLCXD1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PLCXD1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FLJ11323, PI-PLC X domain-containing protein 1
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NUJ7
Immunogen:
The immunogen for anti-PLCXD1 antibody is: synthetic peptide directed towards the C-terminal region of PLCXD1. Synthetic peptide located within the following region: YWWGNRVKTEALIRYLETMKSCGRPGGLFVAGINLTENLQYVLAHPSESL.
GeneID:
55344
Application WB
Background This gene is the most termil protein-coding gene in the pseudoautosomal (PAR) region on chromosomes X and Y. Alterte splicing results in multiple transcript variants.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 1016% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PLCXD1 (3 products)

Catalog No. Species Pres. Purity   Source  

PLCXD1

PLCXD1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PLCXD1

PLCXD1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PLCXD1

PLCXD1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PLCXD1 (3 products)

Catalog No. Species Pres. Purity   Source  

PLCXD1 293T Cell Transient Overexpression Lysate(Denatured)

PLCXD1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PLCXD1 Lysate

Western Blot: PLCXD1 Lysate [NBL1-14493] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PLCXD1
  Novus Biologicals Inc.

PLCXD1 overexpression lysate

PLCXD1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn