TA343258 SEC13 antibody

Rabbit Polyclonal Anti-SEC13 Antibody

See related secondary antibodies

Search for all "SEC13"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish SEC13

Product Description for SEC13

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish SEC13.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SEC13

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms D3S1231E, Protein SEC13 homolog, SEC13-like protein 1, SEC13-related protein, SEC13L1, SEC13R
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P55735
Immunogen:
The immunogen for anti-SEC13 antibody is: synthetic peptide directed towards the C-terminal region of Human SEC13. Synthetic peptide located within the following region: IKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRV.
GeneID:
6396
Application WB
Background The protein encoded by this gene belongs to the SEC13 family of WD-repeat proteins. It is a constituent of the endoplasmic reticulum and the nuclear pore complex. It has similarity to the yeast SEC13 protein, which is required for vesicle biogenesis from endoplasmic reticulum during the transport of proteins. Multiple altertively spliced transcript variants have been found.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 1018% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SEC13 (12 products)

Catalog No. Species Pres. Purity   Source  

SEC13 (transcript variant 1)

SEC13 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SEC13 (1-322, His-tag)

SEC13 Human Purified > 95 % E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

SEC13 (1-322, His-tag)

SEC13 Human Purified > 95 % E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

SEC13

SEC13 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SEC13

SEC13 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SEC13

SEC13 Human Purified
  Abnova Taiwan Corp.

SEC13

SEC13 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SEC13

SEC13 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SEC13

SEC13 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SEC13

SEC13 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SEC13

SEC13 Human Purified
  Novus Biologicals Inc.

SEC13

SEC13 Human Purified
  Novus Biologicals Inc.

Positive controls for SEC13 (3 products)

Catalog No. Species Pres. Purity   Source  

SEC13L1 293T Cell Transient Overexpression Lysate(Denatured)

SEC13L1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SEC13 overexpression lysate

SEC13 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

SEC13 overexpression lysate

SEC13 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn