TA343298 SMN1 / SMN2 antibody

Rabbit Polyclonal Anti-SMN1 Antibody

See related secondary antibodies

Search for all "SMN1 / SMN2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat SMN1 / SMN2

Product Description for SMN1 / SMN2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat SMN1 / SMN2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SMN1 / SMN2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Component of gems 1, Gemin-1, Gemin1, SMN, SMNC, SMNT, Survival motor neuron protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q16637
Immunogen:
The immunogen for anti-SMN1 antibody is: synthetic peptide directed towards the C-terminal region of SMN1. Synthetic peptide located within the following region: PPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSL.
GeneID:
6606
Application WB
Background SMN1 localizes to both the cytoplasm and the nucleus. Within the nucleus, the protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs). This protein forms heteromeric complexes with proteins such as SIP1 and GEMIN4, and also interacts with several proteins known to be involved in the biogenesis of snRNPs, such as hnRNP U protein and the small nucleolar R binding protein.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 1058% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SMN1 / SMN2 (8 products)

Catalog No. Species Pres. Purity   Source  

SMN1 / SMN2 (transcript variant d)

SMN1 / SMN2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SMN1 / SMN2 (transcript variant b)

SMN1 / SMN2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SMN1 / SMN2 (transcript variant b)

SMN1 / SMN2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SMN1 / SMN2

SMN1 / SMN2 Human Purified
  Abnova Taiwan Corp.

SMN1 / SMN2

SMN1 / SMN2 Human 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SMN1 / SMN2

SMN1 / SMN2 Human 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SMN1 / SMN2

SMN1 / SMN2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SMN1 / SMN2

SMN1 / SMN2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SMN1 / SMN2 (7 products)

Catalog No. Species Pres. Purity   Source  

Gemin 1 Lysate

Western Blot: Gemin 1 Lysate [NBL1-16243] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SMN1
  Novus Biologicals Inc.

SMN1 overexpression lysate

SMN1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

SMN1 overexpression lysate

SMN1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

SMN2 293T Cell Transient Overexpression Lysate(Denatured)

SMN2 293T Cell Transient Overexpression Lysate(Denatured) Transient overexpression cell lysate was tested with Anti-SMN2 antibody (H00006607-B01) by Western Blots.
  Abnova Taiwan Corp.

SMN2 overexpression lysate

SMN2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

SMN2 overexpression lysate

SMN2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

SMN2 overexpression lysate

SMN2 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn