TA343333 OAF antibody

Rabbit Polyclonal Anti-OAF Antibody

See related secondary antibodies

Search for all "OAF"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat OAF

Product Description for OAF

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat OAF.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for OAF

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HCV NS5A-transactivated protein 13 target protein 2, NS5ATP13TP2, Out at first protein homolog
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86UD1
Immunogen:
The immunogen for anti-OAF antibody is: synthetic peptide directed towards the N-terminal region of Human OAF. Synthetic peptide located within the following region: PLLGTGAPAELRVRVRLPDGQVTEESLQADSDADSISLELRKPDGTLVSF.
GeneID:
220323
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 1093% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for OAF (1 products)

Catalog No. Species Pres. Purity   Source  

OAF

OAF Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.
  • LinkedIn