TA343335 PANK2 antibody

Rabbit Polyclonal Anti-PANK2 Antibody

See related secondary antibodies

Search for all "PANK2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish PANK2

Product Description for PANK2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish PANK2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PANK2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C20orf48, Pantothenate kinase 2 mitochondrial, Pantothenic acid kinase 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BZ23
Immunogen:
The immunogen for anti-PANK2 antibody is: synthetic peptide directed towards the C-terminal region of Human PANK2. Synthetic peptide located within the following region: FEEALEMASRGDSTKVDKLVRDIYGGDYERFGLPGWAVASSFGNMMSKEK.
GeneID:
80025
Application WB
Background This gene encodes a protein belonging to the pantothete kise family and is the only member of that family to be expressed in mitochondria. Pantothete kise is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynthetic pathway leading to CoA and is itself subject to regulation through feedback inhibition by acyl CoA species. Mutations in this gene are associated with HARP syndrome and pantothete kise-associated neurodegeneration (PKAN), formerly Hallervorden-Spatz syndrome. Altertive splicing, involving the use of alterte first exons, results in multiple transcripts encoding different isoforms.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 1095% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PANK2 (5 products)

Catalog No. Species Pres. Purity   Source  

PANK2 (transcript variant 1)

PANK2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PANK2

PANK2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PANK2

PANK2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PANK2

PANK2 Human
  Abnova Taiwan Corp.

PANK2

PANK2 Human
  Abnova Taiwan Corp.

Positive controls for PANK2 (3 products)

Catalog No. Species Pres. Purity   Source  

PANK2 Lysate

Western Blot: PANK2 Lysate [NBL1-14091] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for PANK2.
  Novus Biologicals Inc.

PANK2 overexpression lysate

PANK2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PANK2 overexpression lysate

PANK2 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn