TA343351 STRA8 antibody

Rabbit Polyclonal Anti-STRA8 Antibody

See related secondary antibodies

Search for all "STRA8"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rat STRA8

Product Description for STRA8

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rat STRA8.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for STRA8

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Stimulated by retinoic acid gene 8 protein homolog
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z7C7
Immunogen:
The immunogen for anti-Stra8 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Stra8. Synthetic peptide located within the following region: FLDKSEAQHMSNISAMFATCNSENPEEKFQLYIQIIEFFKSLGCVNTPLN.
GeneID:
346673
Application WB
Background Stra8 is a meiosis-inducer required for the transition into meiosis for both female and male germ cells. In female germ cells, It is required for premeiotic D replication and subsequent events in meiotic prophase.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 1111% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for STRA8 (1 products)

Catalog No. Species Pres. Purity   Source  

STRA8 Lysate

Western Blot: STRA8 Lysate [NBL1-16567] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for STRA8
  Novus Biologicals Inc.
  • LinkedIn