TA343352 STIM2 antibody

Rabbit Polyclonal Anti-STIM2 Antibody

See related secondary antibodies

Search for all "STIM2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat STIM2

Product Description for STIM2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat STIM2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for STIM2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1482, Stromal interaction molecule 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9P246
Immunogen:
The immunogen for anti-Stim2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Stim2. Synthetic peptide located within the following region: IFSPASRVYNGILEKSCSMHQLSSGIPVPHPRHTSCSSAGNDSKPVQEAS.
GeneID:
57620
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 1112% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for STIM2 (1 products)

Catalog No. Species Pres. Purity   Source  

STIM2

STIM2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.
  • LinkedIn