TA343355 Kynurenine 3-monooxygenase / KMO antibody

Rabbit Polyclonal Anti-KMO Antibody

See related secondary antibodies

Search for all "Kynurenine 3-monooxygenase / KMO"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Kynurenine 3-monooxygenase / KMO

Product Description for Kynurenine 3-monooxygenase / KMO

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Kynurenine 3-monooxygenase / KMO.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Kynurenine 3-monooxygenase / KMO

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Kynurenine 3-hydroxylase
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O15229
Immunogen:
The immunogen for anti-KMO antibody is: synthetic peptide directed towards the N-terminal region of Human KMO. Synthetic peptide located within the following region: RLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFD.
GeneID:
8564
Application WB
Background This gene encodes a mitochondrion outer membrane protein that catalyzes the hydroxylation of L-tryptophan metabolite, L-kynurenine, to form L-3-hydroxykynurenine. Studies in yeast identified this gene as a therapeutic target for Huntington disease.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 1115% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Kynurenine 3-monooxygenase / KMO (6 products)

Catalog No. Species Pres. Purity   Source  

Kynurenine 3-monooxygenase / KMO

Kynurenine 3-monooxygenase / KMO Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Kynurenine 3-monooxygenase / KMO (C-term AVI tag)

Kynurenine 3-monooxygenase / KMO Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Kynurenine 3-monooxygenase / KMO (N-term AVI tag, C-term MYC/DDK tag)

Kynurenine 3-monooxygenase / KMO Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Kynurenine 3-monooxygenase / KMO (full length, C-term DDK tag)

Kynurenine 3-monooxygenase / KMO Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
SF9 cells
20 µg / €411.00
  OriGene Technologies, Inc.

Kynurenine 3-monooxygenase / KMO

Kynurenine 3-monooxygenase / KMO Human in vitro transl.
  Abnova Taiwan Corp.

Kynurenine 3-monooxygenase / KMO

Kynurenine 3-monooxygenase / KMO Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Kynurenine 3-monooxygenase / KMO (1 products)

Catalog No. Species Pres. Purity   Source  

KMO 293T Cell Transient Overexpression Lysate(Denatured)

KMO 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn