TA343361 GGA2 antibody

Rabbit Polyclonal Anti-GGA2 Antibody

See related secondary antibodies

Search for all "GGA2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat GGA2

TA343361

Product Description for GGA2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat GGA2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GGA2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ADP-ribosylation factor-binding protein GGA2, Gamma-adaptin-related protein 2, Golgi-localized gamma ear-containing ARF-binding protein 2, KIAA1080, VEAR, VHS domain and ear domain of gamma-adaptin
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UJY4
Immunogen:
The immunogen for anti-GGA2 antibody is: synthetic peptide directed towards the N-terminal region of Human GGA2. Synthetic peptide located within the following region: MLKKQGIIKQDPKLPVDKILPPPSPWPKSSIFDADEEKSKLLTRLLKSNH.
GeneID:
23062
Application WB
Background This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) family. This family includes ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome. These proteins share an amino-termil VHS domain which mediates sorting of the mannose 6-phosphate receptors at the trans-Golgi network. They also contain a carboxy-termil region with homology to the ear domain of gamma-adaptins. This family member may play a significant role in cargo molecules regulation and clathrin-coated vesicle assembly.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 1121% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GGA2 (3 products)

Catalog No. Species Pres. Purity   Source  

GGA2

GGA2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

GGA2

GGA2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GGA2

GGA2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for GGA2 (2 products)

Catalog No. Species Pres. Purity   Source  

GGA2 293T Cell Transient Overexpression Lysate(Denatured)

GGA2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

GGA2 overexpression lysate

GGA2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn