TA343375 TEAD3 / TEF5 antibody

Rabbit Polyclonal Anti-TEAD3 Antibody

See related secondary antibodies

Search for all "TEAD3 / TEF5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish TEAD3 / TEF5

TA343375

More Views

  • TA343375

Product Description for TEAD3 / TEF5

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish TEAD3 / TEF5.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for TEAD3 / TEF5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DTEF-1, TEA domain family member 3, TEAD-3, TEAD5, Transcriptional enhancer factor TEF-5
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99594
Immunogen:
The immunogen for anti-TEAD3 antibody: synthetic peptide directed towards the C terminal of human TEAD3. Synthetic peptide located within the following region: MMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD.
GeneID:
7005
Application WB
IHC
Background TEAD3 is a member of the transcriptiol enhancer factor (TEF) family. The family members contain the TEA/ATTS D-binding domain. This member is preferentially expressed in placenta and transactivates the chorionic somatomammotropin gene enhancer.This gene encodes a member of the transcriptiol enhancer factor (TEF) family. The family members contain the TEA/ATTS D-binding domain. This member is preferentially expressed in placenta and transactivates the chorionic somatomammotropin gene enhancer. The protein is encoded through the use of a non-AUG (ATA) translation initiation codon.This gene encodes a member of the transcriptiol enhancer factor (TEF) family. The family members contain the TEA/ATTS D-binding domain. This member is preferentially expressed in placenta and transactivates the chorionic somatomammotropin gene enhancer. The protein is encoded through the use of a non-AUG (ATA) translation initiation codon.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TEAD3 / TEF5 (4 products)

Catalog No. Species Pres. Purity   Source  

TEAD3 / TEF5

TEAD3 / TEF5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TEAD3 / TEF5

TEAD3 / TEF5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TEAD3 / TEF5

TEAD3 / TEF5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TEAD3 / TEF5

TEAD3 / TEF5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TEAD3 / TEF5 (1 products)

Catalog No. Species Pres. Purity   Source  

TEAD3 Lysate

Western Blot: TEAD3 Lysate [NBL1-16805] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TEAD3
  Novus Biologicals Inc.
  • LinkedIn