TA343377 AP-2 beta / TFAP2B antibody

Rabbit Polyclonal Anti-TFAP2B Antibody

See related secondary antibodies

Search for all "AP-2 beta / TFAP2B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish AP-2 beta / TFAP2B

Product Description for AP-2 beta / TFAP2B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish AP-2 beta / TFAP2B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for AP-2 beta / TFAP2B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Activating enhancer-binding protein 2 beta, Transcription factor AP2 beta
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q92481
Immunogen:
The immunogen for anti-TFAP2B antibody: synthetic peptide directed towards the N terminal of human TFAP2B. Synthetic peptide located within the following region: MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGP.
GeneID:
7021
Application WB
Background TFAP2B belongs to the AP-2 family which is developmentally regulated and have distinct overlapping functions in the regulation of many genes governing growth and differentiation. TFAP2B binds D as a dimmer and can form homodimers or heterodimers with other AP-2 family members. It may be a candidate for conferring susceptibility to type 2 didabetes.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for AP-2 beta / TFAP2B (7 products)

Catalog No. Species Pres. Purity   Source  

AP-2 beta / TFAP2B (full length, N-term HIS tag)

AP-2 beta / TFAP2B Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

AP-2 beta / TFAP2B

AP-2 beta / TFAP2B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

AP-2 beta / TFAP2B

AP-2 beta / TFAP2B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

AP-2 beta / TFAP2B

AP-2 beta / TFAP2B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

AP-2 beta / TFAP2B

AP-2 beta / TFAP2B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

AP-2 beta / TFAP2B

AP-2 beta / TFAP2B Human Purified
  Novus Biologicals Inc.

AP-2 beta / TFAP2B

AP-2 beta / TFAP2B Human Purified
  Novus Biologicals Inc.
  • LinkedIn