TA343384 ZFX antibody

Rabbit Polyclonal Anti-ZFX Antibody

See related secondary antibodies

Search for all "ZFX"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ZFX

Product Description for ZFX

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ZFX.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZFX

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger X-chromosomal protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P17010
Immunogen:
The immunogen for anti-ZFX antibody: synthetic peptide directed towards the N terminal of human ZFX. Synthetic peptide located within the following region: MDEDGLELQQEPNSFFDATGADGTHMDGDQIVVEVQETVFVSDVVDSDIT.
GeneID:
7543
Application WB
Background ZFX is a probable transcriptiol activator.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn