TA343387 ZFY antibody

Rabbit Polyclonal Anti-ZFX Antibody

See related secondary antibodies

Search for all "ZFY"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ZFY

Product Description for ZFY

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ZFY.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZFY

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger Y-chromosomal protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P08048
Immunogen:
The immunogen for Anti-ZFX antibody is: synthetic peptide directed towards the C-terminal region of Human ZFX. Synthetic peptide located within the following region: QCEYCEYSTTDASGFKRHVISIHTKDYPHRCEYCKKGFRRPSEKNQHIMR.
GeneID:
7544
Application WB
Background ZFX is a probable transcriptiol activator.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZFY (1 products)

Catalog No. Species Pres. Purity   Source  

ZFY overexpression lysate

ZFY overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn