TA343396 ZNF133 antibody

Rabbit Polyclonal Anti-ZNF133 Antibody

See related secondary antibodies

Search for all "ZNF133"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat ZNF133

TA343396

Product Description for ZNF133

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat ZNF133.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF133

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ZNF150, Zinc finger protein 133, Zinc finger protein 150
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P52736
Immunogen:
The immunogen for anti-ZNF133 antibody: synthetic peptide directed towards the N terminal of human ZNF133. Synthetic peptide located within the following region: MAFRDVAVDFTQDEWRLLSPAQRTLYREVMLENYSNLVSLGISFSKPELI.
GeneID:
7692
Application WB
Background ZNF133 may be involved in transcriptiol regulation as a repressor.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF133 (4 products)

Catalog No. Species Pres. Purity   Source  

ZNF133

ZNF133 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZNF133

ZNF133 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZNF133

ZNF133 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZNF133

ZNF133 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ZNF133 (6 products)

Catalog No. Species Pres. Purity   Source  

ZNF133 293T Cell Transient Overexpression Lysate(Denatured)

ZNF133 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF133 293T Cell Transient Overexpression Lysate(Denatured)

ZNF133 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF133 Lysate

Western Blot: ZNF133 Lysate [NBL1-18056] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for ZNF133.
  Novus Biologicals Inc.

ZNF133 overexpression lysate

ZNF133 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ZNF133 overexpression lysate

ZNF133 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

ZNF133 overexpression lysate

ZNF133 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn