TA343403 ZNF177 antibody

Rabbit Polyclonal Anti-ZNF177 Antibody

See related secondary antibodies

Search for all "ZNF177"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Rat ZNF177

Product Description for ZNF177

Rabbit anti Canine, Equine, Human, Mouse, Rat ZNF177.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF177

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 177
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13360
Immunogen:
The immunogen for anti-ZNF177 antibody: synthetic peptide directed towards the N terminal of human ZNF177. Synthetic peptide located within the following region: MAAGWLTTWSQNSVTFQEVAVDFSQEEWALLDPAQKNLYKDVMLENFRNL.
GeneID:
100529215
Application WB
Background ZNF177 contains 1 KRAB domain and 7 C2H2-type zinc fingers. ZNF177 belongs to the krueppel C2H2-type zinc-finger protein family. And it may be involved in transcriptiol regulation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF177 (4 products)

Catalog No. Species Pres. Purity   Source  

ZNF177

ZNF177 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF177

ZNF177 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF177

ZNF177 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF177

ZNF177 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF177 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF177 Lysate

Western Blot: ZNF177 Lysate [NBL1-18071] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZNF177
  Novus Biologicals Inc.

ZNF177 overexpression lysate

ZNF177 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn