TA343410 ZNF205 antibody

Rabbit Polyclonal Anti-ZNF205 Antibody

See related secondary antibodies

Search for all "ZNF205"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast ZNF205

Product Description for ZNF205

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast ZNF205.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF205

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ZNF210, Zinc finger protein 205, Zinc finger protein 210
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95201
Immunogen:
The immunogen for anti-ZNF205 antibody: synthetic peptide directed towards the middle region of human ZNF205. Synthetic peptide located within the following region: PYACPLCGKSFSRRSNLHRHEKIHTTGPKALAMLMLGAAAAGALATPPPA.
GeneID:
7755
Application WB
Background ZNF205 may be involved in transcriptiol regulation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF205 (4 products)

Catalog No. Species Pres. Purity   Source  

ZNF205 (transcript variant 2)

ZNF205 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ZNF205 (transcript variant 1)

ZNF205 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ZNF205

ZNF205 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF205

ZNF205 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF205 (3 products)

Catalog No. Species Pres. Purity   Source  

ZNF205 Lysate

Western Blot: ZNF205 Lysate [NBL1-18084] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZNF205
  Novus Biologicals Inc.

ZNF205 overexpression lysate

ZNF205 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ZNF205 overexpression lysate

ZNF205 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn