TA343451 MED27 antibody

Rabbit Polyclonal Anti-CRSP8 Antibody

See related secondary antibodies

Search for all "MED27"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish MED27

Product Description for MED27

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish MED27.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MED27

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CRSP complex subunit 8, CRSP34, CRSP8, Cofactor required for Sp1 transcriptional activation subunit 8, Mediator complex 27, Mediator of RNA polymerase II transcription subunit 27
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6P2C8
Immunogen:
The immunogen for anti-CRSP8 antibody: synthetic peptide directed towards the C terminal of human CRSP8. Synthetic peptide located within the following region: VVRSFMTWLRSYIKLFQAPCQRCGKFLQDGLPPTWRDFRTLEAFHDTCRQ.
GeneID:
9442
Application WB
Background he activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptiol enhancer sites in D. These factors work with co-activators to direct transcriptiol initiation by the R polymerase II apparatus. CRSP8 is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. CRSP8 is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on D templates in conjunction with initiation factors and cofactors.The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptiol enhancer sites in D. These factors work with co-activators to direct transcriptiol initiation by the R polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on D templates in conjunction with initiation factors and cofactors.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MED27 (4 products)

Catalog No. Species Pres. Purity   Source  

MED27 (1-311, His-tag)

MED27 Human Purified > 80 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

MED27 (1-311, His-tag)

MED27 Human Purified > 80 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

MED27

MED27 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MED27

MED27 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MED27 (2 products)

Catalog No. Species Pres. Purity   Source  

CRSP8 293T Cell Transient Overexpression Lysate(Denatured)

CRSP8 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MED27 Lysate

Western Blot: MED27 Lysate [NBL1-12989] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MED27
  Novus Biologicals Inc.
  • LinkedIn