TA343453 RNF14 antibody

Rabbit Polyclonal Anti-RNF14 Antibody

See related secondary antibodies

Search for all "RNF14"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat RNF14

Product Description for RNF14

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat RNF14.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RNF14

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ARA54, Androgen receptor-associated protein 54, E3 ubiquitin-protein ligase RNF14, HFB30, RING finger protein 14, Triad2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UBS8
Immunogen:
The immunogen for anti-RNF14 antibody: synthetic peptide directed towards the N terminal of human RNF14. Synthetic peptide located within the following region: MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFV.
GeneID:
9604
Application WB
Background RNF14 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A domint negative m
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RNF14 (8 products)

Catalog No. Species Pres. Purity   Source  

RNF14 (transcript variant 1)

RNF14 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RNF14 (transcript variant 4)

RNF14 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RNF14 (transcript variant 5)

RNF14 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RNF14 (transcript variant 3)

RNF14 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RNF14

RNF14 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RNF14

RNF14 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RNF14

RNF14 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RNF14

RNF14 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RNF14 (3 products)

Catalog No. Species Pres. Purity   Source  

RNF14 293T Cell Transient Overexpression Lysate(Denatured)

RNF14 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RNF14 Lysate

Western Blot: RNF14 Lysate [NBL1-15425] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RNF14
  Novus Biologicals Inc.

RNF14 overexpression lysate

RNF14 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn