TA343470 FOXK1 / MNF antibody

Rabbit Polyclonal Anti-Foxk1 Antibody

See related secondary antibodies

Search for all "FOXK1 / MNF"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish FOXK1 / MNF

Product Description for FOXK1 / MNF

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish FOXK1 / MNF.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FOXK1 / MNF

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Forkhead box protein K1, Myocyte nuclear factor
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P42128
Immunogen:
The immunogen for Anti-Foxk1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Foxk1. Synthetic peptide located within the following region: PVPSTAATATATAPALVAAAAASVRQSPGPALARLEGREFEFLMRQPSVT.
GeneID:
17425
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn