TA343479 POU4F2 antibody

Rabbit Polyclonal Anti-POU4F2 Antibody

See related secondary antibodies

Search for all "POU4F2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish POU4F2

Product Description for POU4F2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish POU4F2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for POU4F2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BRN3B, Brain-3B, Brain-specific homeobox/POU domain protein 3B, Brn-3B, POU domain class 4 transcription factor 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q12837
Immunogen:
The immunogen for anti-POU4F2 antibody: synthetic peptide directed towards the middle region of human POU4F2. Synthetic peptide located within the following region: LEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAGI.
GeneID:
5458
Application WB
Background POU4F2 is a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. A class IV POU-domain protein, POU4F2 is found in human reti exclusively within a subpopulation of ganglion cells where it may play a role in determining or maintaining the identities of a small subset of visual system neurons. POU4F2 is a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. A class IV POU-domain protein, POU4F2 is found in human reti exclusively within a subpopulation of ganglion cells where it may play a role in determining or maintaining the identities of a small subset of visual system neurons.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-448 DB082745.1 1-448 449-638 BY796838.2 438-627 639-741 U06233.1 606-708 742-793 X71488.1 62-113 794-2552 U06233.1 761-2519 2553-3141 U06233.1 2522-3110
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for POU4F2 (1 products)

Catalog No. Species Pres. Purity   Source  

POU4F2

POU4F2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for POU4F2 (1 products)

Catalog No. Species Pres. Purity   Source  

POU4F2 overexpression lysate

POU4F2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn