TA343496 NRF1 antibody

Rabbit Polyclonal Anti-NRF1 Antibody

See related secondary antibodies

Search for all "NRF1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish NRF1

TA343496

More Views

  • TA343496
  • TA343496

Product Description for NRF1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish NRF1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NRF1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Alpha palindromic-binding protein, Alpha-pal, NRF-1, Nuclear respiratory factor 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q16656
Immunogen:
The immunogen for anti-NRF1 antibody: synthetic peptide directed towards the N terminal of human NRF1. Synthetic peptide located within the following region: MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPED.
GeneID:
4899
Application WB
Background NRF1 is a phosphorylated nuclear protein with a bZIP domain. This protein homodimerizes and functions as a transcription factor that activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial D transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. This gene encodes a protein that homodimerizes and functions as a transcription factor which activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial D transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alterte transcriptiol splice variants, which encode the same protein, have been characterized. Additiol variants encoding different protein isoforms have been described but they have not been fully characterized. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene and for 'nuclear factor (erythroid-derived 2)-like 1' which has an official symbol of NFE2L1.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NRF1 (5 products)

Catalog No. Species Pres. Purity   Source  

NRF1 (transcript variant 2)

NRF1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NRF1

NRF1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NRF1

NRF1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NRF1

NRF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NRF1

NRF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for NRF1 (2 products)

Catalog No. Species Pres. Purity   Source  

NRF1 Lysate

Western Blot: NRF1 Lysate [NBL1-13788] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NRF1
  Novus Biologicals Inc.

NRF1 Lysate

Western Blot: NRF1 Lysate [NBL1-13789] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NRF1
  Novus Biologicals Inc.
  • LinkedIn