TA343513 ATOH1 antibody

Rabbit Polyclonal Anti-Atoh1 Antibody

See related secondary antibodies

Search for all "ATOH1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat ATOH1

Product Description for ATOH1

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat ATOH1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ATOH1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ATH1, HATH1, MATH-1, Protein atonal homolog 1, bHLHa14
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P48985
Immunogen:
The immunogen for Anti-Atoh1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Atoh1. Synthetic peptide located within the following region: EEWAEVKELGDHHRHPQPHHIPQLTPQPPATLQARDHPVYPAELSLLDST.
GeneID:
11921
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn