TA343519 ARID3A antibody

Rabbit Polyclonal Anti-ARID3A Antibody

See related secondary antibodies

Search for all "ARID3A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Goat, Human, Mouse, Porcine, Rat ARID3A

Product Description for ARID3A

Rabbit anti Bovine, Canine, Guinea Pig, Goat, Human, Mouse, Porcine, Rat ARID3A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ARID3A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ARID domain-containing protein 3A, AT-rich interactive domain-containing protein 3A, B-cell regulator of IgH transcription, Bright, DRIL1, DRIL3, DRX, Dead ringer-like protein 1, E2F-binding protein 1, E2FBP1
Presentation Purified
Reactivity Bov, Can, GP, Gt, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99856
Immunogen:
The immunogen for anti-ARID3A antibody: synthetic peptide directed towards the N terminal of human ARID3A. Synthetic peptide located within the following region: MKLQAVMETLLQRQQRARQELEARQQLPPDPPAAPPGRARAAPDEDREPE.
GeneID:
1820
Application WB
Background ARID3A is a member of the ARID (AT-rich interaction domain) family of proteins which bind D. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptiol regulation and possibly in chromatin structure modification.This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind D. It was found by its homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptiol regulation and possibly in chromatin structure modification. This gene encodes a member of the ARID (AT-rich interaction domain) family of D binding proteins. It was found by homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptiol regulation, and possibly in chromatin structure modification. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-396 BC060828.1 1-396 397-2254 U88047.1 307-2164 2255-2766 CR598405.1 1491-2002 2767-2823 BC060828.1 2769-2825
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ARID3A (5 products)

Catalog No. Species Pres. Purity   Source  

ARID3A

ARID3A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ARID3A

ARID3A Human Purified
  Abnova Taiwan Corp.

ARID3A

ARID3A Human Purified
  Abnova Taiwan Corp.

ARID3A

ARID3A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ARID3A

ARID3A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ARID3A (3 products)

Catalog No. Species Pres. Purity   Source  

ARID3A Lysate(Denatured)

ARID3A Lysate(Denatured)
  Abnova Taiwan Corp.

ARID3A overexpression lysate

ARID3A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

DRIL1 Lysate

DRIL1 Lysate [NBL1-07684] Protein
  Novus Biologicals Inc.
  • LinkedIn