TA343525 Homeobox protein goosecoid-2 / GSC2 antibody

Rabbit Polyclonal Anti-GSCL Antibody

See related secondary antibodies

Search for all "Homeobox protein goosecoid-2 / GSC2"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Homeobox protein goosecoid-2 / GSC2

TA343525

More Views

  • TA343525

Product Description for Homeobox protein goosecoid-2 / GSC2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Homeobox protein goosecoid-2 / GSC2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Homeobox protein goosecoid-2 / GSC2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GSC-2, GSCL, Homeobox protein goosecoid-like
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O15499
Immunogen:
The immunogen for anti-GSCL antibody: synthetic peptide directed towards the C terminal of human GSCL. Synthetic peptide located within the following region: LEALFVQNQYPDVSTRERLAGRIRLREERVEVWFKNRRAKWRHQKRASAS.
GeneID:
2928
Application WB
IHC
Background Goosecoidlike (GSCL) resides in the critical region for VCFS/DGS on 22q11. Velocardiofacial syndrome (VCFS) is phenotypically related to DiGeorge syndrome (DGS) and both syndromes are associated with hemizygous 22q11 deletions. Because many of the tissues and structures affected in VCFS/DGS derive from the pharyngeal arches of the developing embryo, it is believed that haploinsufficiency of a gene involved in embryonic development may be responsible for its etiology.Goosecoidlike (GSCL), a homeodomain-containing gene, resides in the critical region for VCFS/DGS on 22q11. Velocardiofacial syndrome (VCFS) is a developmental disorder characterized by conotruncal heart defects, craniofacial anomalies, and learning disabilities. VCFS is phenotypically related to DiGeorge syndrome (DGS) and both syndromes are associated with hemizygous 22q11 deletions. Because many of the tissues and structures affected in VCFS/DGS derive from the pharyngeal arches of the developing embryo, it is believed that haploinsufficiency of a gene involved in embryonic development may be responsible for its etiology. The gene is expressed in a limited number of adult tissues, as well as in early human development.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn