TA343552 TCF20 / SPBP antibody

Rabbit Polyclonal Anti-TCF20 Antibody

See related secondary antibodies

Search for all "TCF20 / SPBP"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat TCF20 / SPBP

Product Description for TCF20 / SPBP

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat TCF20 / SPBP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TCF20 / SPBP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AR1, KIAA0292, SPRE-binding protein, Stromelysin 1 PDGF-responsive element-binding protein, Transcription factor 20
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UGU0
Immunogen:
The immunogen for anti-TCF20 antibody: synthetic peptide directed towards the C terminal of human TCF20. Synthetic peptide located within the following region: HYPCAIDADCLLHEENFSVRCPKHKPPLPCPLPPLQNKTAKGSLSTEQSE.
GeneID:
6942
Application WB
Background The protein encoded by this gene binds a platelet-derived growth factor-responsive element in the matrix metalloproteise 3 (stromelysin 1) promoter. The protein localizes to the nucleus and displays D-binding and transactivation activities. It is thought to be a transcriptiol coactivator, enhancing the activity of transcription factors such as JUN and SP1.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn