TA343555 ZNF239 antibody

Rabbit Polyclonal Anti-ZNF239 Antibody

See related secondary antibodies

Search for all "ZNF239"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Goat, Human ZNF239

Product Description for ZNF239

Rabbit anti Goat, Human ZNF239.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF239

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HOK-2, HOK2, MOK-2, MOK2, Zinc finger protein 239
Presentation Purified
Reactivity Gt, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q16600
Immunogen:
The immunogen for anti-ZNF239 antibody: synthetic peptide directed towards the N terminal of human ZNF239. Synthetic peptide located within the following region: MASTITGSQDCIVNHRGEVDGEPELDISPCQQWGEASSPISRNRDSVMTL.
GeneID:
8187
Application WB
Background ZNF239 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers. ZNF239 may be involved in transcriptiol regulation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF239 (5 products)

Catalog No. Species Pres. Purity   Source  

ZNF239 (transcript variant 1)

ZNF239 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ZNF239

ZNF239 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF239

ZNF239 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF239

ZNF239 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF239

ZNF239 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF239 (3 products)

Catalog No. Species Pres. Purity   Source  

ZNF239 293T Cell Transient Overexpression Lysate(Denatured)

ZNF239 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF239 Lysate

Western Blot: ZNF239 Lysate [NBL1-18097] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZNF239
  Novus Biologicals Inc.

ZNF239 overexpression lysate

ZNF239 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn