TA343558 NR1H3 antibody

Rabbit Polyclonal Anti-NR1H3 Antibody

See related secondary antibodies

Search for all "NR1H3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish NR1H3

Product Description for NR1H3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish NR1H3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NR1H3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LXRA, Liver X receptor alpha, Nuclear orphan receptor LXR-alpha, Nuclear receptor subfamily 1 group H member 3, Oxysterols receptor LXR-alpha
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13133
Immunogen:
The immunogen for anti-NR1H3 antibody: synthetic peptide directed towards the C terminal of human NR1H3. Synthetic peptide located within the following region: IHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWD.
GeneID:
10062
Application WB
Background Interaction of NR1H3 with RXR shifts RXR from its role as a silent D-binding partner to an active ligand-binding subunit in mediating retinoid responses through target genes defined by LXRES. NR1H3 are DR4-type response elements characterized by direct repeats of two similar hexanuclotide half-sites spaced by four nucleotides. NR1H3 Plays an important role in the regulation of cholesterol homeostasis.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NR1H3 (3 products)

Catalog No. Species Pres. Purity   Source  

NR1H3 (transcript variant 1)

NR1H3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NR1H3

NR1H3 Human in vitro transl.
  Abnova Taiwan Corp.

NR1H3

NR1H3 Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for NR1H3 (2 products)

Catalog No. Species Pres. Purity   Source  

LXR-alpha Lysate

Western Blot: LXR alpha Lysate [NBL1-13768] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for NR1H3.
  Novus Biologicals Inc.

NR1H3 293T Cell Transient Overexpression Lysate(Denatured)

NR1H3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn