TA343560 ZNF263 antibody

Rabbit Polyclonal Anti-ZNF263 Antibody

See related secondary antibodies

Search for all "ZNF263"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ZNF263

Product Description for ZNF263

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ZNF263.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF263

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FPM315, ZKSCAN12, Zinc finger protein 263, Zinc finger protein FPM315, Zinc finger protein with KRAB and SCAN domains 12
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O14978
Immunogen:
The immunogen for anti-ZNF263 antibody: synthetic peptide directed towards the middle region of human ZNF263. Synthetic peptide located within the following region: CHECGDSFSHSSNRIRHLRTHTGERPYKCSECGESFSRSSRLMSHQRTHT.
GeneID:
10127
Application WB
Background ZNF263 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers, 1 KRAB domain and 1 SCAN box domain. ZNF263 might play an important role in basic cellular processes as a transcriptiol repressor.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF263 (8 products)

Catalog No. Species Pres. Purity   Source  

ZNF263

ZNF263 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF263

ZNF263 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF263

ZNF263 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF263

ZNF263 Human Purified
  Abnova Taiwan Corp.

ZNF263

ZNF263 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF263

ZNF263 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF263

ZNF263 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZNF263

ZNF263 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ZNF263 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF263 293T Cell Transient Overexpression Lysate(Denatured)

ZNF263 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn