TA343575 ZBTB16 antibody

Rabbit Polyclonal Anti-ZBTB16 Antibody

See related secondary antibodies

Search for all "ZBTB16"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Rabbit, Rat, Zebrafish ZBTB16

TA343575

More Views

  • TA343575
  • TA343575

Product Description for ZBTB16

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Rabbit, Rat, Zebrafish ZBTB16.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZBTB16

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PLZF, Promyelocytic leukemia zinc finger protein, ZNF145, Zinc finger and BTB domain-containing protein 16, Zinc finger protein 145
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q05516
Immunogen:
The immunogen for anti-ZBTB16 antibody: synthetic peptide directed towards the C terminal of human ZBTB16. Synthetic peptide located within the following region: GASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPDWRIEKTYLYLCYV.
GeneID:
7704
Application WB
Background ZBTB16 is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alterte transcriptiol splice variants have been characterized.This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alterte transcriptiol splice variants have been characterized.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZBTB16 (4 products)

Catalog No. Species Pres. Purity   Source  

ZBTB16 (transcript variant 1)

ZBTB16 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ZBTB16

ZBTB16 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZBTB16

ZBTB16 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZBTB16

ZBTB16 Human
  Abnova Taiwan Corp.
  • LinkedIn