TA343576 TSC22D1 antibody

Rabbit Polyclonal Anti-TSC22D1 Antibody

See related secondary antibodies

Search for all "TSC22D1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish TSC22D1

Product Description for TSC22D1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish TSC22D1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TSC22D1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cerebral protein 2, KIAA1994, Regulatory protein TSC-22, TGFB-stimulated clone 22 homolog, TGFB1I4, TSC22, TSC22 domain family protein 1, Transforming growth factor beta-1-induced transcript 4 protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15714
Immunogen:
The immunogen for anti-TSC22D1 antibody: synthetic peptide directed towards the middle region of human TSC22D1. Synthetic peptide located within the following region: ASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKEL.
GeneID:
8848
Application WB
Background TSC22D1 belongs to the TSC-22/Dip/Bun family. It is a transcriptiol repressor. TSC22D1 acts on the C-type triuretic peptide (CNP) promoter.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TSC22D1 (5 products)

Catalog No. Species Pres. Purity   Source  

TSC22D1

TSC22D1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TSC22D1

TSC22D1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TSC22D1

TSC22D1 Human Purified
  Abnova Taiwan Corp.

TSC22D1

TSC22D1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TSC22D1

TSC22D1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TSC22D1 (2 products)

Catalog No. Species Pres. Purity   Source  

TSC22D1 293T Cell Transient Overexpression Lysate(Denatured)

TSC22D1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TSC22D1 Lysate

Western Blot: TSC22D1 Lysate [NBL1-17351] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TSC22D1
  Novus Biologicals Inc.
  • LinkedIn