TA343588 NR4A2 antibody

Rabbit Polyclonal Anti-NR4A2 Antibody

See related secondary antibodies

Search for all "NR4A2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish NR4A2

TA343588

More Views

  • TA343588

Product Description for NR4A2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish NR4A2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for NR4A2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Immediate-early response protein NOT, NOT, NURR1, Orphan nuclear receptor NURR1, TINUR, Transcriptionally-inducible nuclear receptor
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P43354
Immunogen:
The immunogen for anti-NR4A2 antibody: synthetic peptide directed towards the N terminal of human NR4A2. Synthetic peptide located within the following region: MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTE.
GeneID:
4929
Application WB
IHC
Background NR4A2 is a member of the steroid-thyroid hormone-retinoid receptor superfamily. The protein may act as a transcription factor. Mutations in NR4A2 gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of NR4A2 gene may be associated with rheumatoid arthritis.This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of this gene may be associated with rheumatoid arthritis. Four transcript variants encoding four distinct isoforms have been identified for this gene. Additiol alterte splice variants may exist, but their full length ture has not been determined.This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of this gene may be associated with rheumatoid arthritis. Altertively spliced transcript variants have been described, but their biological validity has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NR4A2 (4 products)

Catalog No. Species Pres. Purity   Source  

NR4A2

NR4A2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NR4A2

NR4A2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NR4A2

NR4A2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NR4A2

NR4A2 Human
  Abnova Taiwan Corp.

Positive controls for NR4A2 (2 products)

Catalog No. Species Pres. Purity   Source  

Nurr1 Lysate

Western Blot: Nurr1 Lysate [NBL1-13779] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NR4A2
  Novus Biologicals Inc.

Nurr1 Lysate

Western Blot: Nurr1 Lysate [NBL1-13780] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NR4A2
  Novus Biologicals Inc.
  • LinkedIn