TA343594 PPAR-delta antibody

Rabbit Polyclonal Anti-PPARD Antibody

See related secondary antibodies

Search for all "PPAR-delta"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat PPAR-delta

TA343594

More Views

  • TA343594

Product Description for PPAR-delta

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat PPAR-delta.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for PPAR-delta

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NR1C2, NUCI, Nuclear hormone receptor 1, Nuclear receptor subfamily 1 group C member 2, PPAR-beta, PPARB, PPARD, Peroxisome proliferator-activated receptor delta
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q03181
Immunogen:
The immunogen for anti-PPARD antibody: synthetic peptide directed towards the C terminal of human PPARD. Synthetic peptide located within the following region: AQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY.
GeneID:
5467
Application WB
IHC
Background PPARD is a member of the peroxisome proliferator-activated receptor (PPAR) family. PPARs are nuclear hormone receptors that bind peroxisome proliferators and control the size and number of peroxisomes produced by cells. PPARs mediate a variety of biologic
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PPAR-delta (9 products)

Catalog No. Species Pres. Purity   Source  

PPAR-delta (transcript variant 1)

PPAR-delta Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PPAR-delta

PPAR-delta Human Purified > 50 % Greater than 90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  OriGene Technologies GmbH

PPAR-delta

PPAR-delta Human Purified > 50 % Greater than 90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  OriGene Technologies GmbH

PPAR-delta

PPAR-delta Human Purified > 50 % Greater than 90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  OriGene Technologies GmbH

PPAR-delta

PPAR-delta Human
  Abnova Taiwan Corp.

PPAR-delta

PPAR-delta Human in vitro transl.
  Abnova Taiwan Corp.

PPAR-delta

PPAR-delta Human in vitro transl.
  Abnova Taiwan Corp.

PPAR-delta

PPAR-delta Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PPAR-delta

PPAR-delta Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PPAR-delta (3 products)

Catalog No. Species Pres. Purity   Source  

PPAR delta Lysate

Western Blot: PPAR delta Lysate [NBL1-14632] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PPARD
  Novus Biologicals Inc.

PPARD overexpression lysate

PPARD overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

PPARD overexpression lysate

PPARD overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn